PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00052020001
Common NameGSBRNA2T00052020001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 207aa    MW: 22435 Da    PI: 9.1841
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00052020001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.1e-403089362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         +++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  GSBRNA2T00052020001 30 QEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNAKRS 89
                         7899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.3E-333187IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-243381IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3943387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MQDPAAYYQS MMAKQLHQQQ QQQQPQFPDQ EQLKCPRCDS PNTKFCYYNN YNLSQPRHFC  60
KSCRRYWTKG GALRNVPVGG GSRKNAKRST SSSTSPSNSH KKAKTPDPDP DSQKETNPDT  120
DPTRMLYGFP IGDQDVKGME MGGGGGGSFS SLLASNMQLG LGGIMLDGSG WDPGMGLGMG  180
LRRSEAGNGG GGSPWTDLAM NRVEKN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00052020001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893443e-94AC189344.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042J11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622887.11e-150PREDICTED: dof zinc finger protein DOF3.1-like isoform X1
RefseqXP_013685054.11e-150PREDICTED: dof zinc finger protein DOF3.1-like isoform X1
RefseqXP_013685055.11e-150PREDICTED: dof zinc finger protein DOF3.1-like isoform X1
SwissprotQ94AR69e-90DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLA0A078H1401e-152A0A078H140_BRANA; BnaC03g42040D protein
STRINGBra001822.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.12e-76DOF zinc finger protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]